Filtyp
LU Holding AB 556500-1467 Box 117, SE - 221 00 Lund, Sweden, Visiting address The Spark, Medicon village, Scheeletorget 1, Lund Telephone +46 46-222 00 00 Internet www.innovation.lu.se 1 A" rsredovisning för LU Holding AB 556500-1467 Räkenskapsåret 2023-01-01 – 2023-12-31 Transaktion 09222115557517147306 Signerat CW, KE, JA, HP, CE, UR, RM, EU, ME LU Holding AB 556500-1467 Box 117, SE - 221 00
Lund Psychological Reports Volume 16, No. 1, 2017 Do we trust the poor? Probing a game paradigm for measuring discriminatory behavior Anna Lindqvist and Fredrik Björklund Department of Psychology, Lund University, Sweden Lund Psychological Reports Editor: Magnus Lindgren ISSN 1404-8035 2 Abstract The aim of the present research was to evaluate a computerized version of the Trust game as a method f
https://www.psy.lu.se/sites/psy.lu.se/files/lpr_1601.pdf - 2026-05-22
PURPOSE: We conducted a cross-sectional study to evaluate long-term outcomes of epilepsy surgery in tuberous sclerosis complex (TSC) in a Swedish population.METHODS: Demographic and seizure data was retrieved from the Swedish National Epilepsy Surgery Registry and medical records. Patient reported outcome measurements (PROM) were determined by telephonic interviews at long term follow-up.RESULTS:
Supported lipid bilayers (SLBs) are one of the most common cell-membrane model systems to study cell-cell interactions. Nickel-chelating lipids are frequently used to functionalize the SLB with polyhistidine-tagged ligands. We show here that these lipids by themselves can induce calcium signaling in T cells, also when having protein ligands on the SLB. This is important to avoid “false” signaling
Methods. A 3-month pharmacokinetic substudy of the prospective, randomized, multicentre, open-label Symphony study was performed. Eighty-three adult renal transplant patients received standard-dose cyclosporine, MMF 2 g/day and corticosteroids, or daclizumab induction, MMF 2 g/day and corticosteroids plus low-dose cyclosporine, low-dose tacrolimus or low-dose sirolimus. The area under the concentr
Purpose: Quantification of cerebral blood flow can be accomplished by model-free arterial spin labeling using the quantitative STAR labeling of arterial regions (QUASAR) sequence. The required deconvolution is normally based on block-circulant singular value decomposition (cSVD)/oscillation SVD (oSVD), an algorithm associated with nonphysiological residue functions and potential effects of arteria
Ibrutinib, a Bruton’s tyrosine kinase inhibitor is approved for relapsed/refractory and del(17p)/TP53 mutated chronic lymphocytic leukemia. Discrepancies between clinical trials and routine healthcare are commonly observed in oncology. Herein we report real-world results for 95 poor prognosis Swedish patients treated with ibrutinib in a compassionate use program. Ninety-five consecutive patients (
Objective: Sex cord-stromal tumours of the ovary are relatively uncommon neoplasms that account for 3 % of all ovarian cancers. Uterine preservation with careful staging is achievable; however, conservative surgery remains controversial. This study examined the prognostic effects of uterine preservation in patients with stage I sex cord-stromal tumours. Study design: This retrospective cohort stud
In Pb-free solder alloys used in solder balls of diameter of 50 µm or smaller, larger proportion of Cu6Sn5 intermetallics formation is a major reliability concern, and this is aggravated in presence of external thermal gradient. A complete understanding of the mechanism for intermetallics compound (IMC) growth under thermomigration is essential for devising solder materials resistant to degradatio
PURPOSE: To compare absolute cerebral blood flow (CBF) estimates obtained by model-free arterial spin labeling (ASL) and dynamic susceptibility contrast MRI (DSC-MRI), corrected for partial volume effects (PVEs). METHODS: CBF was measured using DSC-MRI and model-free ASL (quantitative signal targeting with alternating radiofrequency labeling of arterial regions) at 3 T in 15 subjects with brain tu
Despite intense efforts to develop radiotracers to detect cancers or monitor treatment response, few are widely used as a result of challenges with demonstrating clear clinical use. We reasoned that a radiotracer targeting a validated clinical biomarker could more clearly assess the advantages of imaging cancer. The virtues and shortcomings of measuring secreted prostate-specific antigen (PSA), an
Processing of complex cell preparations such as blood and peripheral blood progenitor cell (PBPC) transplants using label-free technologies is challenging. Transplant-contaminating neuroblastoma cells (NBCs) can contribute to relapse, and we therefore aimed to provide proof-of-principle evidence that label-free acoustophoretic separation can be applied for diagnostic NBC enrichment and removal ("p
INTRODUCTION: We studied whether adding percent free prostate-specific antigen (%fPSA) to total PSA improves prediction of clinically significant prostate cancer (csPCa) and fatal PCa.METHODS: 6727 men within the intervention arm of the Prostate, Lung, Colorectal and Ovarian Trial had baseline %fPSA. Of this cohort, 475 had csPCa and 98 had fatal PCa. Cumulative incidence and Cox analyses were con
Climate counseling – new governance in Swedish agriculture Authors: Dr. Stål, H.* & Professor Corvellec, H** * Herman.stal@usbe.umu.se ; Research Institute for Sustainability and Ethics in Business Umeå School of Business and Economics, Sweden **Lund University A decoupling perspective upon circular business model implementation Track; Circular Business Models Mention that decoupling means somethi
https://www.ses.lu.se/sites/ses.lu.se/files/stahl_160512_presentation.pptx - 2026-05-22
M 7424:1‐11 Landskap: Småland Upptecknat av: Edith Österlund Härad: Västbo Adress: Box 5, Hillerstorp Socken: Kulltorp Berättat av: Densamma Uppteckningsår: 1941 Född år 1895 i Kulltorp Karolina Johansson föddes den 2dra januari på torpet Holkaträdan under Aggarp. Hon var den yngsta av 4 syskon som uppnådde vuxen ålder. 2ne av hennes syskon dog i rödsoten år 185
https://www.folklivsarkivet.lu.se/fileadmin/user_upload/folklivsarkivet/upload/levnadsminne/M_7424_s_1-11.pdf - 2026-05-21
KNOWLEDGE FOR SUSTAINABLE DEVELOPMENT - LUND UNIVERSITY RESEARCH CONFERENCE Short cuts 9.00-10.00 Welcome & Roundtable discussion 10.15-11.00 Thematic parallel session 11.15-12.00 Thematic parallel session 12.00-13.00 Poster session 13.00-14.00 Thematic parallel session 14.10-15.00 Matchmaking & Mingle 15.15-16.30 Panel Debate & Wrap up Extended Posters (.pdf) Conference programme 8.30-9.00 Check-
https://www.sustainability.lu.se/programme-links - 2026-05-21
Extensive graft-derived dopaminergic innervation is maintained 24 years after transplantation in the degenerating parkinsonian brain Extensive graft-derived dopaminergic innervation is maintained 24 years after transplantation in the degenerating parkinsonian brain Wen Lia, Elisabet Englundb, Håkan Widnerc, Bengt Mattssond, Danielle van Westene, Jimmy Lätte, Stig Rehncronaf, Patrik Brunding, Ander
https://www.wnc.lu.se/sites/wnc.lu.se/files/6544.full_.pdf - 2026-05-22
Alcohol-free microemulsions were formulated using mixtures of extended surfactant (C12-14-PO14-EO2SO4Na), sodium dodecyl benzene sulfonic acid and cationic hydrotropes with equal amounts of water and diesel. The cationic hydrotropes had short hydrocarbon or propylene oxide chain. The formulation included sodium carbonate to convert naphthenic acids in diesel to soaps. The phase behavior at ambient
The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka
