Sökresultat

Objective: Sex cord-stromal tumours of the ovary are relatively uncommon neoplasms that account for 3 % of all ovarian cancers. Uterine preservation with careful staging is achievable; however, conservative surgery remains controversial. This study examined the prognostic effects of uterine preservation in patients with stage I sex cord-stromal tumours. Study design: This retrospective cohort stud

We present a simple and rapid microfluidic device capable of extracting and concentrating the parasite causing the fatal disease sleeping sickness (SS) from blood. The device is based on deterministic lateral displacement (DLD) and constructed with a single inlet with flow induced by an ordinary syringe. The simplicity is crucial as the device is intended for use in the resource depraved areas whe

Slow light has been extensively studied for applications ranging from optical delay lines to single photon quantum storage. Here, we show that the time delay of slow-light significantly improves the performance of the narrowband spectral filters needed to optically detect ultrasound from deep inside highly scattering tissue. We demonstrate this capability with a 9 cm thick tissue phantom, having 1

INTRODUCTION: We studied whether adding percent free prostate-specific antigen (%fPSA) to total PSA improves prediction of clinically significant prostate cancer (csPCa) and fatal PCa.METHODS: 6727 men within the intervention arm of the Prostate, Lung, Colorectal and Ovarian Trial had baseline %fPSA. Of this cohort, 475 had csPCa and 98 had fatal PCa. Cumulative incidence and Cox analyses were con

kött eller kompis? Superdatorn Alarik snabbast i syd Higgspartikeln kan hittas redan i år 2 LUM nr 3 | 2012 kontakter värda en mässa LUM nr 3 | 2012 3 arbetsliv. Framtiden kräver ett nytt ledarskap med fokus på värde- ringar! Det tycker Lundaekonomerna som i samband med sin årliga ar- betsmarknadssatsning, eee-dagar- na, arrangerade en ledarskapskon- ferens i Stadshallen i Lund. – Ung ålder förkni

https://www.lu.se/sites/www.lu.se/files/lunds-universitets-magasin-3-2012.pdf - 2026-07-04

FÖR DIG SOM ARBETAR MED REKRYTERING AV INTERNATIONELL PERSONAL Här finns information om vad som gäller när universitetet anställer någon från ett annat land. Stöd i migrationsfrågor sommaren 2026 Under juni 2026 träder vissa migrationsrättsliga förändringar som påverkar universitetssektorn i kraft. Stödet på HR-webben uppdateras under sommaren men sektionen HR kan inte garantera att alla uppdateri

https://www.hr-webben.lu.se/internationell-personal/migrationsfragor - 2026-07-03

Test "Title" ORNIS SCANDINAVICA 17: 221-229. Copenhagen 1986 Number of pairs, timing of egg-laying and clutch size in a subalpine Sand Martin Riparia riparia colony, 1968-1985 Soren Svensson Svensson, S. 1986. Number of pairs, timing of egg-laying and clutch size in a subal- pine Sand Martin Riparia riparia colony, 1968-1985. - Ornis Scand. 17: 221-229. A Sand Martin colony in the subalpine (subar

https://www.luvre.lu.se/sites/luvre.lu.se/files/luvre-069svenssonbacksvala.pdf - 2026-07-04

Purpose: Quantification of cerebral blood flow can be accomplished by model-free arterial spin labeling using the quantitative STAR labeling of arterial regions (QUASAR) sequence. The required deconvolution is normally based on block-circulant singular value decomposition (cSVD)/oscillation SVD (oSVD), an algorithm associated with nonphysiological residue functions and potential effects of arteria

The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka

Radiative lifetimes of 11 levels in Cd I belonging to the 5s5p ¹p^o₁ and 5snd ³D_1,2(n=6-9) and 5sns ³S₁ (n=7,8) series, and of 5 levels of Cd II belonging to the 4d¹⁰5p ²p^o_1/2,3/2, 4d¹⁰6s ²S_1/2, and 4d¹⁰5d ²D_3/2,5/2

The aetiology of benign prostatic hyperplasia (BPH) remains unclear. The objective of the present study was to test the insulin, oestradiol and metabolic syndrome hypotheses as promoters of BPH. The design was a risk factor analysis of BPH in which the total prostate gland volume was related to endocrine and anthropometric factors. The participants studied were 184 representative men, aged 72-76 y

The adult frog sciatic nerve offers several advantages as an in vitro model to study nerve regeneration. The nerve with the attached dorsal root ganglia can easily be isolated and incubated in a culture medium for several days. If the nerve is subjected to a crush immediately after dissection there is a delay of 3.4 days after which the sensory axons start to regenerate into the distal nerve stump

In Pb-free solder alloys used in solder balls of diameter of 50 µm or smaller, larger proportion of Cu6Sn5 intermetallics formation is a major reliability concern, and this is aggravated in presence of external thermal gradient. A complete understanding of the mechanism for intermetallics compound (IMC) growth under thermomigration is essential for devising solder materials resistant to degradatio

Tissue arachidonic acid (AA) pools originate from the diet, and from hepatic and extrahepatic desaturation-elongation of dietary linoleic acid (LA). This review summarizes the roles of absorption, transport, and formation of AA in the buildup of tissue AA pools. In humans who ingest 0.2-0.3 g of AA and 10-20 g of LA per day on a Western diet, the formation of AA from LA exceeds the dietary supply

PURPOSE: We conducted a cross-sectional study to evaluate long-term outcomes of epilepsy surgery in tuberous sclerosis complex (TSC) in a Swedish population.METHODS: Demographic and seizure data was retrieved from the Swedish National Epilepsy Surgery Registry and medical records. Patient reported outcome measurements (PROM) were determined by telephonic interviews at long term follow-up.RESULTS:

Processing of complex cell preparations such as blood and peripheral blood progenitor cell (PBPC) transplants using label-free technologies is challenging. Transplant-contaminating neuroblastoma cells (NBCs) can contribute to relapse, and we therefore aimed to provide proof-of-principle evidence that label-free acoustophoretic separation can be applied for diagnostic NBC enrichment and removal ("p

PURPOSE: To compare absolute cerebral blood flow (CBF) estimates obtained by model-free arterial spin labeling (ASL) and dynamic susceptibility contrast MRI (DSC-MRI), corrected for partial volume effects (PVEs). METHODS: CBF was measured using DSC-MRI and model-free ASL (quantitative signal targeting with alternating radiofrequency labeling of arterial regions) at 3 T in 15 subjects with brain tu

Despite intense efforts to develop radiotracers to detect cancers or monitor treatment response, few are widely used as a result of challenges with demonstrating clear clinical use. We reasoned that a radiotracer targeting a validated clinical biomarker could more clearly assess the advantages of imaging cancer. The virtues and shortcomings of measuring secreted prostate-specific antigen (PSA), an

Alcohol-free microemulsions were formulated using mixtures of extended surfactant (C12-14-PO14-EO2SO4Na), sodium dodecyl benzene sulfonic acid and cationic hydrotropes with equal amounts of water and diesel. The cationic hydrotropes had short hydrocarbon or propylene oxide chain. The formulation included sodium carbonate to convert naphthenic acids in diesel to soaps. The phase behavior at ambient