Sökresultat

Forskningsområdet studerar organiseringen av välfärdspraktiker och de aktörer som verkar där, som professionella, men också som klienter, brukare, volontärer, besökare och liknande. Fokus ligger på det sociala arbetet och dess organisationer. Forskningen bygger därmed vidare på en tradition vid Socialhögskolan i Lund att kritiskt granska institutioner och institutionalisering. Området studerar ockThe research area studies the organization of welfare practitioners and the actors who work there, as professionals, but also as clients, users, volunteers and visitors, with focus on social work and its organizations. The research is thus based on a tradition at the Lund University to critically examine institutions and institutionalization. The area also studies professions, professionalization,

Centrum för handelsforskning vid Lunds universitet VERKSAMHETSBERÄTTELSE | 2020 2 VERKSAMHETSBERÄTTELSE CENTRUM FÖR HANDELSFORSKNING 2020 3 VERKSAMHETSBERÄTTELSE CENTRUM FÖR HANDELSFORSKNING 2020 Inledning Centrum för handelsforskning – det sjunde året För oss precis som för många andra har 2020 varit ett speciellt år. Corona har utmanat oss, på många olika sätt. En omedel- bar effekt var att det

https://www.lusem.lu.se/sites/lusem.lu.se/files/2024-01/verksamhetsberattelse-2020.pdf - 2026-05-11

LU Holding AB 556500-1467 Box 117, SE - 221 00 Lund, Sweden, Visiting address The Spark, Medicon village, Scheeletorget 1, Lund Telephone +46 46-222 00 00 Internet www.innovation.lu.se 1 AÅ rsredovisning för LU Holding AB 556500-1467 Räkenskapsåret 2020-01-01 – 2020-12-31 Transaktion 09222115557446406774 Signerat BA, JA, SF, BN, HP, CW, CE, UR, ST, LW, ME LU Holding AB 556500-1467 Box 117, SE -

https://www.innovation.lu.se/sites/innovation.lu.se/files/2021-08/LU%20Holding%20a%CC%8Arsredovisning%202020.pdf - 2026-05-11

Skissernas Museum – Museum of Artistic Process and Public Art är ett unikt konstmuseum med fokus på den konstnärliga kreativa processen. Här finns världens största samling av skisser, modeller och förlagor till svensk och internationell offentlig konst. I de stora utställningssalarna möts modern och samtida konst – från små blyertsteckningar till färgrika monumentala målningar och storskaliga gipsSkissernas Museum – Museum of Artistic Process and Public Art is a unique art museum that focuses on the artistic creative process. It features the world’s largest collection of sketches, models and preparatory work for Swedish and international public art. The large exhibition rooms hold modern and contemporary art – from small pencil drawings to colourful, monumental paintings and large-scale pl

Ämnet Urban design och urbanism handlar om undervisning och forskning som rör stadsplanering och utformning av det offentliga rummet, där ämnet vill verka för en hållbar utveckling. Här ingår bland annat lärare från Masterprogram för hållbar stadsgestaltning (SUDes). Forskningen inom ämnet handlar framför allt om studier av stadsrummet och dess möjligheter. Vidare studeras frågor om social segreThe subject of Urban Design and Urbanism is concerned with teaching and research about city planning and the shaping of the public realm, with a focus on sustainable development. Members of staff from the Master's programme for Sustainable Urban Design are among those who teach on the subject. Research in the subject is primarily concerned with studies of urban spaces and their potential. Additi

Uppsatsen har undersökt huruvida spelföretaget Star Stable Entertainment AB marknadsföring av virtuella valutor och produkter till barn bryter mot EU:s konsumentskyddslagstiftning i ljuset av Sveriges Konsumenters anmälan mot företaget. Uppsatsen har även diskuterat om direktivet om otillbörliga affärs-metoder är anpassat för den digitala miljön med hänsyn till kommissionens aktuella fitness checkThe essay analyses whether the gaming company Star Stable Entertainment AB´s marketing of virtual currencies and other virtual products against chil-dren violates EU consumer law, considering the Swedish Consumers Associ-ation’s complaint against the company. The paper also discusses whether the Unfair Commercial Practice Directive (UCPD) is fit for the digital environ-ment, given the European Com

In 2009, a nationwide initiative was established in order to lead and develop world-leading research in Sweden. Lund University received strategic research funding from the Swedish Foundation for Stategic Research and the Swedish Government for 12 strategic research areas (SRAs) of excellence. Of these 12 SRAs, StemTherapy (the strategic research area for Stem Cells and Regenerative Medicine) cont

20191022 Inresande forskningspraktikanter (grund- eller masterstudenter) Den internationella kommittén vid Institutionen för psykologi har beslutat om riktlinjer för att skapa bra förutsättningar för ett ömsesidigt givande forskningssamarbete mellan inkommande forskningspraktikanter samt ansvariga forskare. Då du som forskare blir kontaktad av internationella studenter som önskar delta i ett forsk

https://www.psy.lu.se/sites/psy.lu.se/files/inresande_forskningspraktikanter.pdf - 2026-05-11

The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka

The tendency to buy expensive and unnecessary goods is a pattern of consumer behavior that is becoming all too common in our society. We consume luxury items to satisfy practical needs that are already satisfied in the quest toward self-fulfillment, or simply to impress those around us. The phenomenon of “status consumption” has become increasingly evident in modern society. Although conspicuous c