Filtyp
LUND UNIVERSITY LIBRARIES www.lub.lu.se/en Our 26 libraries in Lund, Malmö and Helsingborg offer course books and other literature, study places and often study rooms, computers and Wi-Fi. SEARCH FUNCTIONS www.lub.lu.se/en/find Consult the library catalogue LUBcat to find out what literature the libraries hold and whether it is available for lending. You can check your loans as well as order and r
https://www.lub.lu.se/en/sites/lub.lu.se.en/files/libraryguide_1.pdf - 2026-05-20
Microsoft Word - FordjupnGeologi.doc Kvalitetsarbetet inom Geologiska institutionen Institutionen består av två avdelningar, berggrundsgeologi och kvartärgeologi, med sex forskargrupper. Utbildning ges inom geologiprogrammet på grund- och avancerad nivå. Kursutbudet innefattar även fristående kurser, nätbaserade distanskurser, kvällskurser och sommarkurser. För 2009 har vi 122 helårsstudieplatser.
https://www.geologi.lu.se/sites/geologi.lu.se/files/sjalvvardering_av_kvalitetsarbetet.pdf - 2026-05-20
Alcohol-free microemulsions were formulated using mixtures of extended surfactant (C12-14-PO14-EO2SO4Na), sodium dodecyl benzene sulfonic acid and cationic hydrotropes with equal amounts of water and diesel. The cationic hydrotropes had short hydrocarbon or propylene oxide chain. The formulation included sodium carbonate to convert naphthenic acids in diesel to soaps. The phase behavior at ambient
The aetiology of benign prostatic hyperplasia (BPH) remains unclear. The objective of the present study was to test the insulin, oestradiol and metabolic syndrome hypotheses as promoters of BPH. The design was a risk factor analysis of BPH in which the total prostate gland volume was related to endocrine and anthropometric factors. The participants studied were 184 representative men, aged 72-76 y
The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka
The Swedish parliament has decided that by 2045, Sweden will not be a net emitter of greenhouse gases. There is also a goal to have a fossil fuel free transport sector by 2030. However, the transport sector is still dominated by fossil fuels and many efforts are needed to lower emissions. Sweden has a relatively high share of biofuels, around 20% of the energy use in domestictransportation. Howeve
A bisphenol A (2,2-bis(4-hydroxyphenyl)propane, BPA)-free polycarbonate (PC) from a six-membered di-cyclic carbonate, di-trimethylolpropane di-cyclic carbonate (DTMPC), was developed as a new type of PC by ring opening homo-polymerization. The polymerization was controlled by using metal-free organic-based catalyst systems. The results indicated that the conversion rate depends on the basicity of
The adult frog sciatic nerve offers several advantages as an in vitro model to study nerve regeneration. The nerve with the attached dorsal root ganglia can easily be isolated and incubated in a culture medium for several days. If the nerve is subjected to a crush immediately after dissection there is a delay of 3.4 days after which the sensory axons start to regenerate into the distal nerve stump
Tissue arachidonic acid (AA) pools originate from the diet, and from hepatic and extrahepatic desaturation-elongation of dietary linoleic acid (LA). This review summarizes the roles of absorption, transport, and formation of AA in the buildup of tissue AA pools. In humans who ingest 0.2-0.3 g of AA and 10-20 g of LA per day on a Western diet, the formation of AA from LA exceeds the dietary supply
Kulturkrigen på nätet: överträdelser, hegemoni och konsten/ The Online Cultural Wars: Transgression, Hegemony and the Arts w/ Tobias Linné Kulturkrigen på nätet: överträdelser, hegemoni och konsten/ The Online Cultural Wars: Transgression, Hegemony and the Arts Valbar kurs på BFA-nivån/ Optional BFA-Level course Antal hp/Credits: 10 hp Lärare/Teacher: Tobias Linné Tid/Time: 11-15.11, 27.11, 4.12,
https://www.khm.lu.se/sites/khm.lu.se/files/kulturkrigen_pa_natet_0.docx - 2026-05-20
Acute lymphoblastic leukemia (ALL) is the major pediatric cancer diagnosed in economically developed countries with B-cell precursor (BCP)-ALL, accounting for approximately 70% of ALL. Recent genome-wide association studies (GWAS) have provided the first unambiguous evidence for common inherited susceptibility to BCP-ALL, identifying susceptibility loci at 7p12.2, 9p21.3, 10q21.2, and 14q11.2. To
Bisphosphonates bind to bone surfaces and inactivate osteoclasts when they start to resorb the bone. Therefore, immersion of a bone graft in a bisphosphonate solution before implantation may protect it from resorption. We implanted frozen cancellous; bone allografts; into bilateral bone chambers for 6 weeks in 10 rats. One graft in each pair had been immersed in an alendronate solution (1 mg/mL) f
An amperometric enzyme electrode based on laccase for determining phenolic compounds is proposed. The following three types of polymer materials were used for enzyme immobilization on the surface of a glassy-carbon electrode: positively charged cetyl ethyl poly (ethyleneimine) (CEPEI) and negatively charged commercial Nafion and Eastman AQ 29D polymers. The advantages and disadvantages of each of
Purpose Phosphatidylinositol-4, 5-bisphosphate 3-kinase catalytic subunit alpha (PIK3CA) mutations are frequently observed in primary breast cancer. We evaluated their prognostic relevance by performing a pooled analysis of individual patient data. Patients and Methods Associations between PIK3CA status and clinicopathologic characteristics were tested by applying Cox regression models adjusted fo
Soft tissue sarcomas (STS) are characterized by deregulated proliferation. Ki-67 is a cell cycle antigen which may be elevated in proliferative states. We analysed Ki-67 expression in fixed and embedded tissues from STS in order to examine associations between proliferation, primary tumour characteristics, and metastasis. One hundred and eighty-two adult patients with trunk wall or extremity STS w
Methods. A 3-month pharmacokinetic substudy of the prospective, randomized, multicentre, open-label Symphony study was performed. Eighty-three adult renal transplant patients received standard-dose cyclosporine, MMF 2 g/day and corticosteroids, or daclizumab induction, MMF 2 g/day and corticosteroids plus low-dose cyclosporine, low-dose tacrolimus or low-dose sirolimus. The area under the concentr
Purpose: Quantification of cerebral blood flow can be accomplished by model-free arterial spin labeling using the quantitative STAR labeling of arterial regions (QUASAR) sequence. The required deconvolution is normally based on block-circulant singular value decomposition (cSVD)/oscillation SVD (oSVD), an algorithm associated with nonphysiological residue functions and potential effects of arteria
Supported lipid bilayers (SLBs) are one of the most common cell-membrane model systems to study cell-cell interactions. Nickel-chelating lipids are frequently used to functionalize the SLB with polyhistidine-tagged ligands. We show here that these lipids by themselves can induce calcium signaling in T cells, also when having protein ligands on the SLB. This is important to avoid “false” signaling
