Sökresultat

MultiPark NextGen Sequencing (NGS) Platform Description and steering document Short description The Multipark NGS platform is located at the BMC in Lund. It is a NGS facility providing you with services for RNA or DNA isolation, library preparation using Illumina kits to sequencing on our NextSeq500 or at Centre for translational genomics (CTG). Quality checks using Agilent Bioanalyzer and qubit f

https://www.multipark.lu.se/sites/multipark.lu.se/files/2022-10/NGS_styrdokument_20221019%20(kopia)_0.pdf - 2026-05-20

Practical information | Vattenhallen Science Center Skip to main content This site uses cookies to enhance the user experience. By continuing to use the site you agree that cookies are used according to our Cookie Policy (on the website of LTH) . Essential cookies These cookies are necessary for the website to function and cannot be turned off in our systems. These cookies do not store any persona

https://www.vattenhallen.lu.se/vattenhallen-english/visit-us/practical-information/ - 2026-05-21

LUND UNIVERSITY LIBRARIES www.lub.lu.se/en Our 26 libraries in Lund, Malmö and Helsingborg offer course books and other literature, study places and often study rooms, computers and Wi-Fi. SEARCH FUNCTIONS www.lub.lu.se/en/find Consult the library catalogue LUBcat to find out what literature the libraries hold and whether it is available for lending. You can check your loans as well as order and r

https://www.lub.lu.se/sites/lub.lu.se/files/libraryguide_1.pdf - 2026-05-20

LUND UNIVERSITY LIBRARIES www.lub.lu.se/en Our 26 libraries in Lund, Malmö and Helsingborg offer course books and other literature, study places and often study rooms, computers and Wi-Fi. SEARCH FUNCTIONS www.lub.lu.se/en/find Consult the library catalogue LUBcat to find out what literature the libraries hold and whether it is available for lending. You can check your loans as well as order and r

https://www.lub.lu.se/en/sites/lub.lu.se.en/files/libraryguide_1.pdf - 2026-05-20

Syllabus for SIM 202 Faculty of Social Sciences A. Syllabus for SIMS39 Social Sciences: Gender, Global Development and Postcolonialism, 15 credits, second cycle (A1N) The course was adopted by the Dean of the Faculty of Social Sciences on 7 January 2013, in accordance with the delegation of authorities at the Faculty of Social Sciences, reg.no. S2012/60. The syllabus was approved by the Committee

https://www.graduateschool.sam.lu.se/sites/graduateschool.sam.lu.se/files/syllabussims39_0.pdf - 2026-05-20

Arbetsordning för PNL Sida 1 av 16 LAST REVISED 2025-01-28 Rules of Procedure for the Programme Board for Master’s Degrees (PNM) including assignment details FACULTY OF MEDICINE | LUND UNIVERSITY Page 2 of 16 The Programme Board for Master’s Degrees (PNM) RULES OF PROCEDURE with assignment details Decided upon 2025-01-28 by PNM (STYR 2025/2271) Diary number STYR 2024/2271 Last revised 2025-01-28 C

https://www.intramed.lu.se/en/sites/intramed.lu.se.en/files/2025-07/Rules%20of%20Procedure-PNM-2025-01-28.pdf - 2026-05-20

Congratulations and welcome to the course STVN17! Welcome to the Political Science Department at Lund University. Please see the information below that you need to know in order to secure our offer. It is important that you read the information thoroughly. Secure your place – important deadline You must accept the offer no later than 20 July at 23:59 (Swedish time).If you do not accept the offer b

https://www.svet.lu.se/en/education/new-student-admission-information/power-politics-and-environment - 2026-05-21

Extensive graft-derived dopaminergic innervation is maintained 24 years after transplantation in the degenerating parkinsonian brain Extensive graft-derived dopaminergic innervation is maintained 24 years after transplantation in the degenerating parkinsonian brain Wen Lia, Elisabet Englundb, Håkan Widnerc, Bengt Mattssond, Danielle van Westene, Jimmy Lätte, Stig Rehncronaf, Patrik Brunding, Ander

https://www.wnc.lu.se/sites/wnc.lu.se/files/pnas-2016-li-1605245113.pdf - 2026-05-20

Microsoft Word - Sjdlvvdrdering humanekologi Lund _3_.doc 1 GRUND- OCH FORSKARUTBILDNINGEN I HUMANEKOLOGI VID LUNDS UNIVERSITET En självvärdering HUMANEKOLOGISKA RAPPORTER 2 Humanekologiska avdelningen, Lunds universitet 158 HUMANEKOLOGISKA RAPPORTER 2 HUMANEKOLOGISKA RAPPORTER är en serie skrifter utgivna av Humanekologiska avdelningen vid Lunds universitet. Skrifterna utkommer med oregelbundna i

https://www.keg.lu.se/sites/keg.lu.se/files/sjalvvardering_06.pdf - 2026-05-20

Introduction THE STRUGGLE FOR WATER IN JOHANNESBURG A case study of the socio-economic impacts of a corporatised water and sanitation service delivery regime in Phiri and Stretford Extension 4 November 21, 2005 Submitted in partial fulfilment of the requirements for Master’s degree in International Environmental Science, Lund University, Sweden Submitted by: Supervisor: Melissa Hansen Turaj S. Far

https://www.lumes.lu.se/sites/lumes.lu.se/files/melissa_hansen.pdf - 2026-05-20

The agricultural system today Opportunit ies and challenges with the transit ion from fossil to renewable in Arla Foods Anna-Karin Modin Edman, Sustainability manager, ArlaFoods Environmental Strategy 2020 Sustainable Dairy Farming Strategy Animals Climate (-30 % CF, compared to 1990) Resources Nature Sustainable agriculture – responsible sourcing Soy – RTRS, ProTerra or organic Palmoil – RSPO seg

https://www.hallbarhet.lu.se/sites/hallbarhet.lu.se/files/anna-karin_modin-edman_15_maj_2017.pdf - 2026-05-20

Agenda 2030 Graduate School monthly newsletter #9 2023-12-10 Ylva van Meeningen Hi! The holidays are around the corner, with all the added stress and excitement that comes with it. Deadlines need to be met, things need to be finished up, you need to plan for next semester maybe and maybe you are not much into the mood (or maybe you are) and then there are all expectations in between. Hopefully you

https://www.agenda2030graduateschool.lu.se/sites/agenda2030graduateschool.lu.se/files/2024-01/A2030_monthly%20update_231210.pdf - 2026-05-20

A2 Course Description Part 1 (Autumn 2024) Page 1 of 4 Modern Standard Arabic for Beginners A2, Part I This course syllabus and description applies to the 2024 fall semester. General Information This is an Arabic language course offered by the Centre for Advanced Middle Eastern Studies (CMES) exclusively for Lund University staff and students interested in working and conducting research in Arabic

https://www.cmes.lu.se/sites/cmes.lu.se/files/2024-09/A2%20(Part%201)%20Course%20description%20fall%202024.pdf - 2026-05-20

Students at the Social Sciences Faculty in Lund, unable to bring a laptop of their own, can apply to borrow a computer for classes that require a computer. Please note that the computer can only be connected to a local network available in the lecture halls on campus. It cannot be used in any other location.Software on the computersArcGisArcGisProDjVuEndnoteGephiJamoviJASPNvivoRR-studioSPSSSPSS Am

https://www.sam.lu.se/en/form/book-computer-use-class - 2026-05-21

Acute lymphoblastic leukemia (ALL) is the major pediatric cancer diagnosed in economically developed countries with B-cell precursor (BCP)-ALL, accounting for approximately 70% of ALL. Recent genome-wide association studies (GWAS) have provided the first unambiguous evidence for common inherited susceptibility to BCP-ALL, identifying susceptibility loci at 7p12.2, 9p21.3, 10q21.2, and 14q11.2. To

Alcohol-free microemulsions were formulated using mixtures of extended surfactant (C12-14-PO14-EO2SO4Na), sodium dodecyl benzene sulfonic acid and cationic hydrotropes with equal amounts of water and diesel. The cationic hydrotropes had short hydrocarbon or propylene oxide chain. The formulation included sodium carbonate to convert naphthenic acids in diesel to soaps. The phase behavior at ambient

The aetiology of benign prostatic hyperplasia (BPH) remains unclear. The objective of the present study was to test the insulin, oestradiol and metabolic syndrome hypotheses as promoters of BPH. The design was a risk factor analysis of BPH in which the total prostate gland volume was related to endocrine and anthropometric factors. The participants studied were 184 representative men, aged 72-76 y

The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka

The Swedish parliament has decided that by 2045, Sweden will not be a net emitter of greenhouse gases. There is also a goal to have a fossil fuel free transport sector by 2030. However, the transport sector is still dominated by fossil fuels and many efforts are needed to lower emissions. Sweden has a relatively high share of biofuels, around 20% of the energy use in domestictransportation. Howeve