Filetype
Tissue arachidonic acid (AA) pools originate from the diet, and from hepatic and extrahepatic desaturation-elongation of dietary linoleic acid (LA). This review summarizes the roles of absorption, transport, and formation of AA in the buildup of tissue AA pools. In humans who ingest 0.2-0.3 g of AA and 10-20 g of LA per day on a Western diet, the formation of AA from LA exceeds the dietary supply
The adult frog sciatic nerve offers several advantages as an in vitro model to study nerve regeneration. The nerve with the attached dorsal root ganglia can easily be isolated and incubated in a culture medium for several days. If the nerve is subjected to a crush immediately after dissection there is a delay of 3.4 days after which the sensory axons start to regenerate into the distal nerve stump
How do we reach zero climate impact? Stefan Nyström, the Administrative Director of the All Party Committee on Environmental Objectives (Miljömålsberedningen*) and researchers from Lund University will discuss how to turn words into action in the Swedish climate policy on the road towards zero emissions. Anders Wijkman, who was earlier announced as the speaker has had to cancel his participation d
https://www.hallbarhet.lu.se/sites/hallbarhet.lu.se/files/seminar_zero_climate_impact_28_okt_a3_rev27okt_low.pdf - 2026-05-23
Alcohol-free microemulsions were formulated using mixtures of extended surfactant (C12-14-PO14-EO2SO4Na), sodium dodecyl benzene sulfonic acid and cationic hydrotropes with equal amounts of water and diesel. The cationic hydrotropes had short hydrocarbon or propylene oxide chain. The formulation included sodium carbonate to convert naphthenic acids in diesel to soaps. The phase behavior at ambient
The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka
The aetiology of benign prostatic hyperplasia (BPH) remains unclear. The objective of the present study was to test the insulin, oestradiol and metabolic syndrome hypotheses as promoters of BPH. The design was a risk factor analysis of BPH in which the total prostate gland volume was related to endocrine and anthropometric factors. The participants studied were 184 representative men, aged 72-76 y
A bisphenol A (2,2-bis(4-hydroxyphenyl)propane, BPA)-free polycarbonate (PC) from a six-membered di-cyclic carbonate, di-trimethylolpropane di-cyclic carbonate (DTMPC), was developed as a new type of PC by ring opening homo-polymerization. The polymerization was controlled by using metal-free organic-based catalyst systems. The results indicated that the conversion rate depends on the basicity of
PowerPoint-presentation Blood perfusion and oxygenation in human eyelid skin flaps examined by laser speckle contrast imaging and hyperspectral imaging – importance of flap length JOSEFINE BUNKE1,2, PERNILLA ROSENQVIST1,2, ABOMA MERDASA1,3, MALIN MALMSJÖ1 1DEPARTMENT OF CLINICAL SCIENCES LUND, OPHTHALMOLOGY, LUND UNIVER SITY AND SKÅNE UNIVERSITY HOSPITAL, LUND, SWEDEN 2DEPARTMENT OF RESEARCH AND D
A flat-well microformat competitive enzyme-linked immunosorbent chemiluminescent assay for the detection of the pesticide 2,4-dichlorophenoxyacetic acid (2,4-D) is described. Thick-film technology was used to pattern a hydrophobic layer 100 μm thick onto glass microscope slides to form an array of 2 × 2 mm2 squares. These flat wells were able to hold 2 μL of reagents, corresponding to a heig
Purpose: Statin use has been consistently associated with improved clinical outcomes (especially recurrence) in breast cancer in multiple observational studies backed by compelling preclinical evidence. The strength of this evidence warrants a clinical trial to test the efficacy of statin exposure on breast cancer recurrence. Patients and Methods: The double-blind, phase III, randomized, placebo-c
Background Comparison of patients with coronary heart disease and controls in genome-wide association studies has revealed several single nucleotide polymorphisms (SNPs) associated with coronary heart disease. We aimed to establish the external validity of these findings and to obtain more precise risk estimates using a prospective cohort design. Methods We tested 13 recently discovered SNPs for a
Acute lymphoblastic leukemia (ALL) is the major pediatric cancer diagnosed in economically developed countries with B-cell precursor (BCP)-ALL, accounting for approximately 70% of ALL. Recent genome-wide association studies (GWAS) have provided the first unambiguous evidence for common inherited susceptibility to BCP-ALL, identifying susceptibility loci at 7p12.2, 9p21.3, 10q21.2, and 14q11.2. To
Soft tissue sarcomas (STS) are characterized by deregulated proliferation. Ki-67 is a cell cycle antigen which may be elevated in proliferative states. We analysed Ki-67 expression in fixed and embedded tissues from STS in order to examine associations between proliferation, primary tumour characteristics, and metastasis. One hundred and eighty-two adult patients with trunk wall or extremity STS w
BACKGROUND:: Pneumococcal conjugate vaccine (PCV) was introduced in 2000. The first 7-valent vaccine was followed by a 13-valent vaccine (PCV13) with the same conjugate, and a 10-valent vaccine (PCV10), conjugated to protein D from H. influenzae. The vaccines offer some protection against pneumococcal acute otitis media (AOM), and, with PCV10, possibly also some protection against H. influenzae AO
LUND UNIVERSITY LIBRARIES www.lub.lu.se/en Our 26 libraries in Lund, Malmö and Helsingborg offer course books and other literature, study places and often study rooms, computers and Wi-Fi. SEARCH FUNCTIONS www.lub.lu.se/en/find Consult the library catalogue LUBcat to find out what literature the libraries hold and whether it is available for lending. You can check your loans as well as order and r
https://www.lub.lu.se/en/sites/lub.lu.se.en/files/libraryguide_1.pdf - 2026-05-23
LUND UNIVERSITY LIBRARIES www.lub.lu.se/en Our 26 libraries in Lund, Malmö and Helsingborg offer course books and other literature, study places and often study rooms, computers and Wi-Fi. SEARCH FUNCTIONS www.lub.lu.se/en/find Consult the library catalogue LUBcat to find out what literature the libraries hold and whether it is available for lending. You can check your loans as well as order and r
https://www.lub.lu.se/sites/lub.lu.se/files/libraryguide_1.pdf - 2026-05-23
Microsoft Word - COSM10 course schedule 2021.docx Centre for East and South-East Asian Studies COSM10 Asian Studies: Asian Studies, 6 credits Autumn semester 2021, 30 August – 22 September Course schedule (Preliminary 2021-06-16) Course information The course offers an introduction to critical, interdisciplinary Asian Studies, its historical origin, research history, and some cross-cutting issues
https://www.ace.lu.se/sites/ace.lu.se/files/2021-06/COSM10%20course%20schedule%202021.pdf - 2026-05-23
BACKGROUND: Treatment of newly diagnosed advanced-stage ovarian cancer typically involves cytoreductive surgery and systemic chemotherapy. We conducted a trial to investigate whether the addition of hyperthermic intraperitoneal chemotherapy (HIPEC) to interval cytoreductive surgery would improve outcomes among patients who were receiving neoadjuvant chemotherapy for stage III epithelial ovarian ca
Measurements of the hygroscopic properties of sub-micrometer atmospheric aerosol particles were performed with hygroscopic tandem differential mobility analysers (H-TDMA) at 5 sites in the subtropical north-eastern Atlantic during the second Aerosol Characterization Experiment (ACE-2) from 16 June to 25 July 1997. Four of the sites were in the marine boundary layer and one was, at least occasional
Programme for Research Symposium 18/4 2019 Life Cycles: Human Reproduction, Growth, and Development Time: Thursday May 9th 2019, start 10:00, end Friday May 10th 2019 at 16:00 p.m. Venue: “Jubileumsaulan” Lecture Hall, Jan Waldenströms gata 2-5, Skåne University Hospital (SUS), Malmö, Sweden Organisers: The Strategic Research Area (SRA) Epidemiology for Health (EpiHealth) at Lund and Uppsala Unive
