Filetype
Postal address P.O. Box 117, SE-221 00 Lund Visiting address Sandgatan 3, building R, Gamla Kirurgen Telephone +46 46 222 00 00 Website www.sam.lu.se/en Social SGR014F Financial Sustainability and Illicit Financial Flows 7.5 credits The reading list was approved by the Research Studies Council 27 May 2020, and is valid from the autumn semester 2020. Books: Baker, R. W. 2005. “Capitalism’s Achilles
KNOWLEDGE FOR SUSTAINABLE DEVELOPMENT - LUND UNIVERSITY RESEARCH CONFERENCE Short cuts 9.00-10.00 Welcome & Roundtable discussion 10.15-11.00 Thematic parallel session 11.15-12.00 Thematic parallel session 12.00-13.00 Poster session 13.00-14.00 Thematic parallel session 14.10-15.00 Matchmaking & Mingle 15.15-16.30 Panel Debate & Wrap up Extended Posters (.pdf) Conference programme 8.30-9.00 Check-
https://www.sustainability.lu.se/programme-links - 2026-05-21
Practical information | Vattenhallen Science Center Skip to main content This site uses cookies to enhance the user experience. By continuing to use the site you agree that cookies are used according to our Cookie Policy (on the website of LTH) . Essential cookies These cookies are necessary for the website to function and cannot be turned off in our systems. These cookies do not store any persona
https://www.vattenhallen.lu.se/vattenhallen-english/visit-us/practical-information/ - 2026-05-21
LUM nr 2 - 2005 I BrobyggareBrobyggare L U N D S U N I V E R S I T E T M E D D E L A R - - - - - - - - - - - - - - - - N U M M E R 2 F E B 2 0 0 5 Å R G Å N G 3 8 Vetenskap till kaffet Uppror på Ekonomi- högskolan II Lunds universitets tidskrift LUM utkom första gången 1968. Den når i dag samtliga anställda och nästan lika många utanför universitetet. LUM har en upplaga på 12.800 ex och utkommer m
https://www.lu.se/sites/www.lu.se/files/lunds-universitets-magasin-2-2005.pdf - 2026-05-22
Despite intense efforts to develop radiotracers to detect cancers or monitor treatment response, few are widely used as a result of challenges with demonstrating clear clinical use. We reasoned that a radiotracer targeting a validated clinical biomarker could more clearly assess the advantages of imaging cancer. The virtues and shortcomings of measuring secreted prostate-specific antigen (PSA), an
INTRODUCTION: We investigated the natural history of the relationship between PSA at age 60 and lifetime risk of prostate cancer death in an unscreened cohort followed for 40 years, the Malmö Preventive Project. We also investigated whether percent free PSA could risk-stratify men with low PSAs.METHODS: The cohort included 1162 men aged 58-62 at blood draw in 1981-82, with 1151 deaths by December
libraryguide.indd LUND UNIVERSITY LIBRARIES www.lub.lu.se/en Our 26 libraries in Lund, Malmö and Helsingborg offer course books and other literature, study places and often study rooms, computers and Wi-Fi. The University Library (UB) is a public research library with legal deposit copies of Swedish prints, manuscripts, archives and a range of special collections. SEARCH FUNCTIONS www.lub.lu.se/en
https://www.ub.lu.se/en/sites/ub.lu.se.en/files/the-library-guide-2018-vt.pdf - 2026-05-22
[JRJ 17.1–2 (2024) 8–31] (print) ISSN 1753-8637 https://doi.org/10.1558/jazz.27808 (online) ISSN 1753-8645 © Equinox Publishing Ltd 2024, Office 415, The Workstation, 15 Paternoster Row, Sheffield S1 2BX. Submitted: 2024-02-27 Accepted: 2024-09-18 Do improvisers intend? A small survey Sven Bjerstedt1 Malmö Academy of Music Lund University Sweden sven.bjerstedt@thm.lu.se Abstract Questions about th
pnas201006568 11602..11607 Tracking differentiating neural progenitors in pluripotent cultures using microRNA-regulated lentiviral vectors Rohit Sachdevaa, Marie E. Jönssona, Jenny Nelandera, Agnete Kirkebya, Carolina Guibentifa, Bernhard Gentnerb, Luigi Naldinib, Anders Björklunda, Malin Parmara, and Johan Jakobssona,1 aDepartment of Experimental Medical Sciences, Wallenberg Neuroscience Center,
https://www.molecular-neurogenetics.lu.se/sites/molecular-neurogenetics.lu.se/files/11602.full_.pdf - 2026-05-22
Statistik 10p ekologi BIO 580 Helsingborg HT 2004 Course Summary for NGEN08 Satellite Remote Sensing spring 2022 Course coordinator: Lars Eklundh Teachers: • Jonas Ardö, professor (JA) • Zheng Duan, associate senior lecturer(ZD) • Lars Eklundh, professor (LE) • Helena Elvén Eriksson, lecturer (HEE) • Babak Mohamadi, PhD candidate (BM) • Per-Ola Olsson, postdoctoral researcher, (PO) • Torbern Tages
https://www.nateko.lu.se/sites/nateko.lu.se/files/2023-04/NGEN08%20course%20evauation%202022.pdf - 2026-05-22
Centre for Economic Demography Lund University School of Economics and Management P.O. Box 7083 SE-220 07 Lund, Sweden www.ed.lu/publications/Lund-Papers-in-Economic-Demography/ Adverse Early-Life Conditions and Their Impact on the Marriage Market and Social Mobility: The Poznań Birth Cohort, 1830–1855 SZYMON ANTOSIK, TOMMY BENGTSSON, PIOTR ANTOSIK, GRAŻYNA LICZBIŃSKA LUND PAPERS IN ECONOMIC DEMOG
https://www.lusem.lu.se/sites/lusem.lu.se/files/2026-02/LPED%202026%201.pdf - 2026-05-22
Keymeulen B Page 1 KEYMEULEN Bart Date, Place of Birth February 14, 1961, Aalst - Belgium Nationality Belgian Address Diabetes Research Center Vrije Universiteit Brussel Laarbeeklaan 103 B-1090 Brussel, Belgium Tel. 32-2-4774541 Fax. 32-2-4774545 E-mail: Bart.Keymeulen@vub.be Diabeteskliniek UZ Brussel Laarbeeklaan 101 B-1090 Brussel, Belgium Tel. 32-2-477 78 76 Fax. 32-2-477 78 03 E-mail: Bart.Ke
https://www.ludc.lu.se/sites/ludc.lu.se/files/engelstalig_academisch_cv_b_keymeulen_08.01.2019.pdf - 2026-05-22
14:30-16:00 Session 3 Room 1: “Issues in Sustainability” Chairperson: Erin Kennedy | Commentator: Torsten Krause Teresa Rauscher (LUMES/Sustainability Science): “Work, Community and Sustainability – Redefining Work through Cohousing” Ina Dodd (LUMES/Environmental Studies): “Intersectionality in the Forest: Connecting Social Diversity and Sustainability in the Swedish Forest Agency” Pedro Campos (C
https://www.graduateschool.sam.lu.se/sites/graduateschool.sam.lu.se/files/masters_thesis_final_program.pdf - 2026-05-22
LL_KSMB45_rev161117 Litteraturlista för Turism och platsutveckling, 15 hp (KSMB45) Litteraturlistan är fastställd av styrelsen för institutionen för service management och tjänstevetenskap 2015-12-10, reviderad senast av styrelsen för service management och tjänstevetenskap 2016-11-17. Litteraturlistan börjar gälla den 2017-01-01. Agarwal, Sheela (1997). The resort cycle and seaside tourism: an as
https://www.ses.lu.se/sites/ses.lu.se/files/ll_ksmb45_rev161117.pdf - 2026-05-22
Tissue arachidonic acid (AA) pools originate from the diet, and from hepatic and extrahepatic desaturation-elongation of dietary linoleic acid (LA). This review summarizes the roles of absorption, transport, and formation of AA in the buildup of tissue AA pools. In humans who ingest 0.2-0.3 g of AA and 10-20 g of LA per day on a Western diet, the formation of AA from LA exceeds the dietary supply
The adult frog sciatic nerve offers several advantages as an in vitro model to study nerve regeneration. The nerve with the attached dorsal root ganglia can easily be isolated and incubated in a culture medium for several days. If the nerve is subjected to a crush immediately after dissection there is a delay of 3.4 days after which the sensory axons start to regenerate into the distal nerve stump
Alcohol-free microemulsions were formulated using mixtures of extended surfactant (C12-14-PO14-EO2SO4Na), sodium dodecyl benzene sulfonic acid and cationic hydrotropes with equal amounts of water and diesel. The cationic hydrotropes had short hydrocarbon or propylene oxide chain. The formulation included sodium carbonate to convert naphthenic acids in diesel to soaps. The phase behavior at ambient
The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka
