Filetype
Botswana has figured widely as the exceptional African growth success story and has been frequently cited in scholarship that supports the view that African and other less developed economies are capable of rapid economic growth as long as the internal institutional framework and development policies are right. A shortcoming of the literature on African economic performance to date is that it has
In 2009, a nationwide initiative was established in order to lead and develop world-leading research in Sweden. Lund University received strategic research funding from the Swedish Foundation for Stategic Research and the Swedish Government for 12 strategic research areas (SRAs) of excellence. Of these 12 SRAs, StemTherapy (the strategic research area for Stem Cells and Regenerative Medicine) cont
Forskningen bedrivs vid avdelningen för infektionsmedicin på BMC i nära samarbete med avdelningen för reumatologi och fokuserar kring nya mekanismer hos neutrofiler (en slags vita blodkroppar) som kan förklara eller prognosticera infektionssjukdom eller infektionskänslighet. Projekten drivs både som translationella studier där vi försöker förklara mekanismerna varför infektionssjukdom uppträder hoOur research is conducted at the division of infection medicine at BMC in close collaboration with the division of rheumatology. The research is focused on new neutrophil mechanisms that can explain or prognosticate infectious diseases. The approach to the projects is either translational, where we try to explain why certain individuals turn ill due to infections, or more clinically focused, where
The Official records of the Swedish Foreign Ministry and War Ministry clearly indicate that the Stockholm was fully aware of the ongoing massacres and deportations of the Armenian subjects in the Ottoman Empire in an intentional annihilation of the Armenian nation.
SDE at Lund University conducts research on the development of new tools, languages, and methods for software development. Example areas include compilers, program analysis, domain-specific languages and tools, meta-programming tools, integrated development environments, code review tools, adaptive developer tools, agile methodology, software architecture and design, pervasive systems, internet-of
The Urban Systems and Dynamics group, led by Prof. Nik, advances the boundaries of Building Physics to explore the complex interactions between buildings, urban systems, and climate. Our research focuses on designing and optimizing strategies for buildings and urban systems (with a big focus on energy systems) that drive the sustainable urban transition and enhance the built environment's resilien
The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka
By building a strong brand that is favourably perceived by target customers, a firm can establish a competitive advantage that enables greater revenues and profitability. This is at least what the branding literature always has assumed, and something few marketing and brand managers seem to disagree with. When asked how exactly a brand can be charged with such great value, however, neither academi
Migratory land birds perform extreme endurance flights when crossing ecological barriers, such as deserts, oceans and ice-caps. When travelling over benign areas, birds are expected to migrate by shorter flight steps, since carrying the heavy fuel loads needed for long non-stop flights comes at considerable cost. Here, we show that great snipes Gallinago media made long and fast non-stop flights (
Group exhibition.'The horizon is always receding' brings together a selection of works that reflect on the scope and the implications that the term contemporary may have. As the philosopher Giorgio Agamben suggests, contemporaneity can be understood as a term that surpasses temporal demarcations and transcends simultaneity and coexistence. In this sense, this exhibition serves as a symptomatic dis
Staben samordnar och utvecklar Lunds universitetets ekonomimodell, förvaltar och utvecklar de IT-system som sektionen Ekonomi ansvarar för. Samordnar och utvecklar sektionens stöd i form av utbildning, information och support. Utvecklar och ansvarar för konsolidering av universitetets totalbudget samt ekonomiska uppföljning och analys. Ger stöd och råd i budget och uppföljningsfrågor. Leder och u
Forskningen inom avdelningen för Elektromagnetism och Nanoelektronik spänner över ett bredd områden från teoretisk elektroteknik och vågutbredning till nanoelektroniska komponenter och system. Tematiskt är forskningsområden indelade i 6 områden: Antenner och vågor, Metamaterial, Nanoelektronik för IoT, neuromorfa elektronik, kvantteknologi, THz och Kraftelektronik. Inom elektromagnetismen läggs sThe research within the Division of Electromagnetism and Nanoelectronics spans a wide range of areas from Electromagnetic Theory and wave propagation to nanoelectronic devices and systems. Thematically, research areas are divided into 6 areas: antennas and waves, metamaterials, nanoelectronics for IoT, neuromorphic computing, quantum technology, THz and Power electronics. Within the electromagnet
• Utveckla och ansvara för universitetets ekonomiska redovisning samt identifiera förbättringsmöjligheter för en rationell ekonomiadministration • Ge stöd, rådgivning, utbildning och information i ekonomi- och systemhanteringsfrågor • Upprätta myndighetens finansiella bokslut och ekonomisk rapportering till ledningen och andra intressenter • Kvalitetssäkra bokföringen • Hantera kund- och leverantö• To develop and take responsibility for the University’s accounting and to identify opportunities for improvement to rationalise financial administration • To provide support, advice, training and information on financial and systems management • To produce the public authority’s financial statements and financial reporting for the management and other stakeholders • Quality assurance of accou
Fokus för forskningen är språkutveckling hos barn med språkstörning och barn med typisk utveckling, som gjorts i samarbete med tidigare doktorander och magisterstudenter. Följande språkliga domäner har studerats: fonologi (uttal och satsmelodi), grammatik och ordförråd. De senaste decennierna har fokus legat på pragmatisk förmåga och barns förmåga till interaktion med sin omgivning, där även barn The research focus is language development in children with language impairment and with typical development, carried out in cooperation with earlier doctoral and master students. The following language domains have been studied: phonology, grammar and lexicon. In later years, focus has been on pragmatic and interactional aspects, also in children with ADHD, autism spectrum disorders and cerebral
