Search results

Filter

Filetype

Your search for "*" yielded 569858 hits

No title

In conjugated polymers the concept of spectroscopic units belonging to different spatial segments of the chain, which are responsible for the spectroscopic properties of the polymer, has been used to explain the spectral heterogeneity and the excitation migration by (Forster type) hopping transfer. In the present work we study the possible mechanism of segmentation of polythiophene into spectrosco

No title

Several studies have tried to link southern oscillation index (Sol) and observed precipitation in Korea and Japan. However, so far no clear relationship between the Sol and the precipitation in the area has been found. In the present study, categorized Sol are used to reveal quantitative and statistically significant influence on monthly precipitation at Busan in Korea and at Fukuoka in Japan. Mon

No title

Arbuscular mycorrhizal (AM) development in different soil types, and the influence of AM fungal hyphae on their original soil were investigated. Plantago lanceolata, which can grow in soils of a very wide pH range, was grown in two closely related limestone soils and an acid soil from rock habitats. Plants were colonised by the indigenous AM fungal community. The use of compartmented systems allow

No title

Purpose: To our knowledge we report the first long-term use of desmopressin for nocturia. Patients previously responding to desmopressin in short-term studies were enrolled in this long-term open label study. Materials and Methods: Patients received treatment for 10 or 12 months with the optimal desmopressin dose (0.1, 0.2 or 0.4 mg orally at bedtime). Patients were followed a further month withou

No title

CONTEXT: Tuberculosis (TB) is an increasing global problem, despite effective drug therapies. Access to TB therapy during conflict situations has not been studied. OBJECTIVE: To determine the effect of irregular TB treatment due to an armed conflict in Guinea-Bissau, West Africa. DESIGN, SETTING, AND PATIENTS: Ongoing retrospective cohort study conducted in the capital city of Bissau among 101 pat

No title

This work concerns exhaust gas cleaning for heavy-duty diesel engines by means of NOx storage and redn. technol. A full-scale engine rig has been constructed, and stationary NOx redn. tests performed. In the NOx storage and redn. approach, NOx is stored on a BaO surface as Ba(NO3)2 under long lean conditions and desorbed and reduced under short rich conditions. The rich conditions are created by i

No title

A new binaphthalene molecule with two spiropyran units used for chiral molecular switches and logic gates was synthesized and chaxacterized.(12) In this paper, charge and energy transfer in binaphthalene molecule with two spiropyran units are theoretically investigated with quantum chemistry method, as well as 2D and 3D real space analysis methods, since molecule construction with photoinduced ele

No title

We have in an earlier paper, [1], presented a generalization, the Linked Dipole Chain Model LDC, of the model developed by Ciafaloni-Catani-Fiorani-Marchesini, [2], to decribe the structure functions and the states in Deep Inelastic Scattering events. In this paper we would like to present an investigation of a set of general features of the LDC Model, viz the behaviour of the structure functions

No title

Popular Abstract in Swedish De perifera nervstammarna i extremiteterna förmedlar signaler, dels till muskler, dels från känselkroppar som är belägna i bl a huden. Nervstammarna kan av olika orsaker utsättas för skador orsakade av vassa eller skärande föremål eller av olika typer av slitvåld. Nervskador ger ett mycket stort handikapp för den enskilde patienten som förlorar muskelfunktion och känselNerve injuries have a profound impact on individuals, suffering for the patients and induce cost for society. When dealing with severe nerve injuries that create a gap between nerve segments or when the injury is at the brachial plexus level, the clinical alternatives are limited. The brachial plexus model and its branches in the forelimb was evaluated as an experimental model for studies of nerve

No title

Kritisk analys av berättartekniken och estetiken i dansk 1990-talsfilm med fokus på Dogma95.

No title

We present an experimental comparison of magnetoconductance fluctuations measured in the ballistic, quasiballistic, and diffusive scattering regimes of semiconductor devices. In contradiction to expectations, we show that the spectral content of the magnetoconductance fluctuations exhibits an identical fractal behavior for these scattering regimes and that this behavior is remarkably insensitive t

No title

Rapport avseende mätningar utförda i experimentanläggning vid Institutionen för Byggnadskonstruktionslära, Lunds Tekniska Högskola. Projektet är en direkt fortsättning av projektet "Temperatur- och fuktmätningar i skorsten vid omväxlande olje- och elvärme (BKL 1986:26)

No title

In free flap surgery, restored blood flow following a lengthy ischaemic period may lead to necrosis as a result of ischaemia/reperfusion (IR) injury. This injury comprises both proinflammatory and prothrombotic events, where the tissue factor/factor VIIa complex probably has a key role. Active site-inactivated factor VIIa (FFR-rFVIIa) exerts an antithrombotic effect by binding to tissue factor wit

No title

Studied the relationship between motivation and approaches to moral decision-making, and the emotions experienced in moral dilemmas. 44 students were interviewed about a dilemma they had faced. Intimacy was related to a preference for making decisions after having consulted others and to being open to their values and norms, whereas achievement was related to consequence-oriented reasoning and con

No title

The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka